Protein Info for ABIE51_RS04420 in Lysobacter sp. OAE881

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 166 to 189 (24 residues), see Phobius details amino acids 206 to 230 (25 residues), see Phobius details amino acids 259 to 288 (30 residues), see Phobius details amino acids 309 to 329 (21 residues), see Phobius details amino acids 349 to 368 (20 residues), see Phobius details PF13466: STAS_2" amino acids 21 to 83 (63 residues), 29.5 bits, see alignment E=6.7e-11 TIGR00056: ABC transport permease subunit" amino acids 136 to 368 (233 residues), 239 bits, see alignment E=3.4e-75 PF02405: MlaE" amino acids 156 to 365 (210 residues), 243.2 bits, see alignment E=2.3e-76

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 70% identity to xal:XALc_2683)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component USSDB6A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>ABIE51_RS04420 ABC transporter permease (Lysobacter sp. OAE881)
MTDTTAHPPQIDADGSTPSRLRLSGSWTLDYAGQIGTALGDAPAGVATIDASGVERLDSV
GVLQLLRFARRNNLDFDVLTFHESHQALVSAIEDVADDRPRKKREYGVSAALERLGRAVH
NNWHEALALVGFLGETQIKLLRMFKEPSRFRPTATVHHMEQVGLDAVPLVALLCFLVGAV
VAFLGANILRDFGAEIFVVELVNISFLREFAVLLTAIVLAGRTASAFTAQIGAMVSREEV
DAIRTLGMDPIDLLVIPRMLALLVMLPMLTFIAMIFGLLGGLTVGAYSLDIPPQQYLTRM
HETIELRHFLVGLAKAPVFALLISLIGCLEGLQVEGTAQSVGERTTSSVVQSISMVIILD
AFFAIWFMEMGV