Protein Info for ABIE51_RS04290 in Lysobacter sp. OAE881

Annotation: UDP-glucose 4-epimerase GalE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01179: UDP-glucose 4-epimerase GalE
  • amino acids 4 to 332 (329 residues), 422 bits, E=6.4e-131
• PF04321: RmlD_sub_bind
  • amino acids 4 to 164 (161 residues), 38.8 bits, E=1.8e-13
• PF02719: Polysacc_synt_2
  • amino acids 5 to 185 (181 residues), 44.6 bits, E=3.3e-15
• PF01370: Epimerase
  • amino acids 5 to 253 (249 residues), 177.6 bits, E=8.6e-56
• PF00106: adh_short
  • amino acids 5 to 113 (109 residues), 26.2 bits, E=1.5e-09
• PF01073: 3Beta_HSD
  • amino acids 6 to 161 (156 residues), 46.4 bits, E=8.4e-16
• PF16363: GDP_Man_Dehyd
  • amino acids 6 to 325 (320 residues), 166.2 bits, E=4.3e-52

Best Hits

Swiss-Prot: 59% identical to GALE_YERPE: UDP-glucose 4-epimerase (galE) from Yersinia pestis

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 67% identity to mpt:Mpe_A1914)

MetaCyc: 56% identical to UDP-glucose 4-epimerase (Bacillus subtilis subtilis 168)
UDP-N-acetylglucosamine 4-epimerase. [EC: 5.1.3.7]; UDP-glucose 4-epimerase. [EC: 5.1.3.7, 5.1.3.2]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• colanic acid building blocks biosynthesis (8/11 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• D-galactose detoxification (1/3 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.7

Protein Sequence (336 amino acids)

>ABIE51_RS04290 UDP-glucose 4-epimerase GalE (Lysobacter sp. OAE881)
MSDRVLVTGGAGFIGSHTCVALAEAGIPFAILDNFSNAHRGVIDRLERIIGFRPSVIDGD
IRDRALLDQTFADGGFGSVIHFAGLKAVGESVEKPVEYYDTNFVGTLRLVQAMRASSCRT
LVFSSSATVYRASAIMPLHEDSALSATSPYGRSKLMVEEMLRDVSAADPQWRIALLRYFN
PVGAHSSGLIGEDPRGIPNNLMPYIGQVATGRLPRLKVFGGDYPTIDGTGVRDYIHVVDL
AEGHLAAMERLKGRPGCLTLNLGTGRGTSVLQMIHAFEAASGRAIPYEIVDRRPGDLAEY
WADPSLAFEELGWRARRSLHDMCADAWRWQVEQGGG