Protein Info for ABIE51_RS04250 in Lysobacter sp. OAE881

Annotation: maleylacetoacetate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02798: GST_N
  • amino acids 5 to 81 (77 residues), 52.3 bits, E=1.2e-17
• PF13417: GST_N_3
  • amino acids 8 to 87 (80 residues), 58.1 bits, E=1.8e-19
• TIGR01262: maleylacetoacetate isomerase
  • amino acids 8 to 218 (211 residues), 312.6 bits, E=6.1e-98
• PF13409: GST_N_2
  • amino acids 14 to 82 (69 residues), 53.7 bits, E=4.9e-18
• PF13410: GST_C_2
  • amino acids 134 to 185 (52 residues), 25.3 bits, E=2.6e-09

Best Hits

Swiss-Prot: 54% identical to MAAI_VIBCH: Probable maleylacetoacetate isomerase (maiA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01800, maleylacetoacetate isomerase [EC: 5.2.1.2] (inferred from 70% identity to xal:XALc_2718)

MetaCyc: 50% identical to glutathion-dependent maleylpyruvate isomerase (Ralstonia sp. U2)
Maleylpyruvate isomerase. [EC: 5.2.1.4]

Predicted SEED Role

"Maleylacetoacetate isomerase (EC 5.2.1.2) @ Glutathione S-transferase, zeta (EC 2.5.1.18)" (EC 2.5.1.18, EC 5.2.1.2)

MetaCyc Pathways

• L-tyrosine degradation I (4/5 steps found)
• gentisate degradation I (2/3 steps found)
• 5-nitroanthranilate degradation (3/6 steps found)
• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• 3-phenylpropanoate degradation (5/10 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (3/10 steps found)
• gliotoxin biosynthesis (1/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450
• Styrene degradation
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18, 5.2.1.2

Use Curated BLAST to search for 2.5.1.18 or 5.2.1.2 or 5.2.1.4

Protein Sequence (221 amino acids)

>ABIE51_RS04250 maleylacetoacetate isomerase (Lysobacter sp. OAE881)
MAAEHLRLYSYWRSSAAYRVRIGLNLKSLPYETVPVHLIRDGGEQHSAAFKQVNPQELVP
VLQHGDRVMRQSVAILEYLDETWPEPPLLPAAARDRQRVRALAQTIACDIHPLNNLRVLQ
HFDRNWHVPQPERDAWVQHWVQEGFTALEAMLADHPSTGTFCEGNSPTLADCCLVPQVYN
ARRFAVDLSKYPTITRIEKACLALPAFDAARPEKQPDAPVA