Protein Info for ABIE51_RS04210 in Lysobacter sp. OAE881

Annotation: cAMP-activated global transcriptional regulator CRP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF00027: cNMP_binding" amino acids 24 to 111 (88 residues), 73.1 bits, see alignment E=2.3e-24 PF13545: HTH_Crp_2" amino acids 151 to 212 (62 residues), 34.9 bits, see alignment E=1.8e-12 PF00325: Crp" amino acids 174 to 203 (30 residues), 43.7 bits, see alignment 2.7e-15

Best Hits

Swiss-Prot: 81% identical to CLP_XANAC: CRP-like protein Clp (clp) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K10914, CRP/FNR family transcriptional regulator, cyclic AMP receptor protein (inferred from 80% identity to psu:Psesu_0327)

Predicted SEED Role

"Cyclic AMP receptor protein" in subsystem CytR regulation or cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>ABIE51_RS04210 cAMP-activated global transcriptional regulator CRP (Lysobacter sp. OAE881)
MRRTNSPLLPDGATIERFLAHCHRRRYPSRTDVFRPGDPASTLYYIVSGSVSIITEEEDG
RELVLGYFGPGEFVGELGLFIASDQREVILRTRSTCELAEIGHERLYDLLLTRLSLDAPK
LLYAIGAQISRRLLDTSRKAGRLAFLDVTDRIVRALHDLAKEPEAMSHPQGTQIRVSRQE
LSRLVGCSREMAGRVLKKLQADGKLHARGKTVVLYGTR