Protein Info for ABIE51_RS04095 in Lysobacter sp. OAE881

Annotation: sodium:calcium antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 68 to 92 (25 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 202 to 226 (25 residues), see Phobius details amino acids 236 to 262 (27 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details amino acids 298 to 316 (19 residues), see Phobius details PF01699: Na_Ca_ex" amino acids 4 to 143 (140 residues), 95.5 bits, see alignment E=1.6e-31 amino acids 173 to 311 (139 residues), 79.4 bits, see alignment E=1.4e-26

Best Hits

KEGG orthology group: K07301, inner membrane protein (inferred from 56% identity to psu:Psesu_2513)

Predicted SEED Role

"FIG01111989: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>ABIE51_RS04095 sodium:calcium antiporter (Lysobacter sp. OAE881)
MLEAIGWFVLGLVLLALGGDSIVKGASGLAQRLGASPFVAGLVLVAFGTSLPELAVNWQA
VARHQPLLALGNAVGSNVANVGLTLGAAALIAPMTVRWRALSPLLLALLLGTLLTMLLGS
DGTLTRVEGFVLLVVFVAVVTYAAIRTRREAPELQDAIAAFARTSTDLWLNLIRFGIAAV
LLYFGSRMVVRSAPTIGEGIGMAPLLTGLIPVAIGTALPEMAAAISAARKGHGDIVVGHV
IGSSLFNVLVVIGGMAAIGGSVAFPESFVMFELPAACVFALMLYPMLRGDLHISKGEGAG
LVIAFLAWVAFELLTMH