Protein Info for ABIE51_RS04085 in Lysobacter sp. OAE881

Annotation: homogentisate 1,2-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 TIGR01015: homogentisate 1,2-dioxygenase" amino acids 7 to 431 (425 residues), 678 bits, see alignment E=2.4e-208 PF20510: HgmA_N" amino acids 8 to 277 (270 residues), 426.4 bits, see alignment E=4.7e-132 PF04209: HgmA_C" amino acids 279 to 431 (153 residues), 244.9 bits, see alignment E=2.7e-77

Best Hits

Swiss-Prot: 78% identical to HGD_XANAC: Homogentisate 1,2-dioxygenase (hmgA) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K00451, homogentisate 1,2-dioxygenase [EC: 1.13.11.5] (inferred from 78% identity to psu:Psesu_2515)

MetaCyc: 57% identical to homogentisate dioxygenase (Aspergillus nidulans)
Homogentisate 1,2-dioxygenase. [EC: 1.13.11.5]

Predicted SEED Role

"Homogentisate 1,2-dioxygenase (EC 1.13.11.5)" in subsystem Homogentisate pathway of aromatic compound degradation (EC 1.13.11.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>ABIE51_RS04085 homogentisate 1,2-dioxygenase (Lysobacter sp. OAE881)
MTITSNGYQSGFGNEFATEAVAGALPVGRNSPQRVAHGLYAEQISGTAFTAPRHANRRSW
LYRIRPAAMHGGFSPYAHPKASFHNDFDDAPISPDQLRWSPLPMPEGGVDFVDALFTMAG
NGSPAAQSGVAIHVYAANRDMQGRWFYDADGELLIVPQQGRLHIETELGVLDVEPQEIAV
IPRGIRFAVTLPDGEARGYVCENFGAMLRLPDLGPIGSNGLANPRDFLAPNAAYEDVDGD
FELVAKFQGHLWRADIGHSPIDVVAWHGNYAPYKYDLRLFNTIGSISFDHPDPSIFLVLH
SPSDTPGTSNMDFVIFPPRWLVAQDTFRPPWFHRNIASEFMGLVHGAYDAKAEGFVPGGA
SLHNSMTGHGPDAATFEKASAADLSKPDVIRDTMAFMFETRAVIRPTKQAIDAAHRQRDY
QACWAGLQKHFDAGR