Protein Info for ABIE51_RS03870 in Lysobacter sp. OAE881

Annotation: PLP-dependent aminotransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 47% identical to YDCR_ECOLI: Uncharacterized HTH-type transcriptional regulator YdcR (ydcR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 67% identity to har:HEAR2824)

Predicted SEED Role

"Transcriptional regulator, GntR family domain / Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)

MetaCyc Pathways

superpathway of L-isoleucine biosynthesis I (13/13 steps found)
superpathway of aromatic amino acid biosynthesis (16/18 steps found)
anaerobic energy metabolism (invertebrates, cytosol) (7/7 steps found)
superpathway of L-phenylalanine biosynthesis (9/10 steps found)
superpathway of L-threonine biosynthesis (6/6 steps found)
superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (14/18 steps found)
aspartate superpathway (19/25 steps found)
L-asparagine degradation III (mammalian) (3/3 steps found)
L-phenylalanine biosynthesis I (3/3 steps found)
superpathway of L-tyrosine biosynthesis (8/10 steps found)
superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
TCA cycle VIII (Chlamydia) (5/6 steps found)
malate/L-aspartate shuttle pathway (2/2 steps found)
L-tyrosine degradation I (4/5 steps found)
3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
L-aspartate biosynthesis (1/1 steps found)
L-aspartate degradation I (1/1 steps found)
superpathway of L-aspartate and L-asparagine biosynthesis (3/4 steps found)
L-tyrosine biosynthesis I (2/3 steps found)
L-glutamate degradation II (1/2 steps found)
L-tryptophan degradation IV (via indole-3-lactate) (1/2 steps found)
L-tyrosine degradation II (1/2 steps found)
atromentin biosynthesis (1/2 steps found)
superpathway of L-methionine biosynthesis (transsulfuration) (6/9 steps found)
trans-4-hydroxy-L-proline degradation I (3/5 steps found)
L-phenylalanine degradation III (2/4 steps found)
L-tyrosine degradation III (2/4 steps found)
C4 photosynthetic carbon assimilation cycle, NAD-ME type (7/11 steps found)
(R)-cysteate degradation (1/3 steps found)
L-phenylalanine degradation II (anaerobic) (1/3 steps found)
L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
indole-3-acetate biosynthesis VI (bacteria) (1/3 steps found)
sulfolactate degradation III (1/3 steps found)
superpathway of plastoquinol biosynthesis (2/5 steps found)
L-tryptophan degradation VIII (to tryptophol) (1/4 steps found)
C4 photosynthetic carbon assimilation cycle, PEPCK type (8/14 steps found)
4-hydroxybenzoate biosynthesis I (eukaryotes) (1/5 steps found)
L-phenylalanine degradation VI (reductive Stickland reaction) (1/5 steps found)
L-tryptophan degradation XIII (reductive Stickland reaction) (1/5 steps found)
L-tyrosine degradation V (reductive Stickland reaction) (1/5 steps found)
coenzyme M biosynthesis II (1/6 steps found)
superpathway of sulfolactate degradation (1/6 steps found)
L-phenylalanine degradation IV (mammalian, via side chain) (3/9 steps found)
superpathway of chorismate metabolism (38/59 steps found)
indole-3-acetate biosynthesis II (4/12 steps found)
(S)-reticuline biosynthesis I (3/11 steps found)
rosmarinic acid biosynthesis I (1/10 steps found)
superpathway of rosmarinic acid biosynthesis (1/14 steps found)
anaerobic aromatic compound degradation (Thauera aromatica) (1/27 steps found)
Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.1

Use Curated BLAST to search for 2.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (467 amino acids)

>ABIE51_RS03870 PLP-dependent aminotransferase family protein (Lysobacter sp. OAE881)
MKRYEALAEDLARSIQSGAFRPGERLPSVRQTTTARRISPSTVFQAYYLLEARGLIESRA
RSGYYVAARPSRLPPEPETSSRPDGDSRPVDVSELVFDVLQSAMHRDLVPFGSAFPSPLL
FPLPKLGRAIAAAAQDLDPWSTVDDLTPGQAELRRQIGLRYLIDGIDVPADEIIVTNGAL
EALNLGIAAVTRPGDAVLVESPCFYAVLQSLERNGLRAIEVPTHPRDGVDLDALEQAIAR
HSPRACWLMPTFHNPLGATMPDDAKRDLVVLLARHGIPLIEDDVYAELHYGARRPLPAKA
FDRDGGVVHCSSFSKCLAPGYRIGWVAAGRFRNTIARNKLTTTLNTNVPAQRAIGRYLQG
GGYDRHLRRLRATLAEQQAKYIEAIATYFPEGTKVTRASGGYFAWIELPEGRDALALHRR
ALEAGISIAPGPIFSASRSFRNCLRINYGHPFDARTEQGLKTLGALA