Protein Info for ABIE51_RS03830 in Lysobacter sp. OAE881

Annotation: 4Fe-4S dicluster domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 387 to 405 (19 residues), see Phobius details PF12801: Fer4_5" amino acids 87 to 126 (40 residues), 28 bits, see alignment 4.2e-10 PF13746: Fer4_18" amino acids 215 to 255 (41 residues), 46.4 bits, see alignment 1e-15 amino acids 313 to 371 (59 residues), 97.6 bits, see alignment 1.4e-31 PF11614: FixG_C" amino acids 402 to 516 (115 residues), 93.4 bits, see alignment E=3e-30

Best Hits

KEGG orthology group: None (inferred from 70% identity to psu:Psesu_0338)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (517 amino acids)

>ABIE51_RS03830 4Fe-4S dicluster domain-containing protein (Lysobacter sp. OAE881)
MNKKISIDLLDDGGNALYVSERKIYPRSVSGVFQTWRNVAVVVLLGMFYVFPWLRWDGRQ
AVLFDLPARKFYVFGLNFWPQDFFLLAVLMIIAGLSLFFFTAIAGRLWCGYACPQTVWTE
VFLWMERWTEGDRNARMKLDAAPWTAHKLLRKGGKHVLWLVFALWTGFTFVGFFTPITDL
AARAPLFGNAPGWGGWETFWVLFYALATWGNAGFLREQVCKYMCPYARFQSAMFDRNTLI
IAYDPMRGEPRGPRKRGLGSVLERARGLLDPATAYDYVFRAARQGNAVTLGAAGTTAVTD
VGLVAQPLPKFEPEQLGDCIDCTICVQVCPTGIDIRNGLQYECIACGACIDACDSVMDKM
GYPKGLIRYSTQNAIDGKPTRVARPRVLLYGVLLLALCVAWAWGVGHRSPLIAEVLRDRN
ALYREAADDRIENTYTLKLVNKDVAPRTFRIRVQAPAGIELRGGPQTVNADAEQVLNLPL
VLSAPEGVRGKQAVTFHVERVDGTANADVASTFFGPM