Protein Info for ABIE51_RS03695 in Lysobacter sp. OAE881

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 309 to 326 (18 residues), see Phobius details amino acids 331 to 353 (23 residues), see Phobius details amino acids 364 to 387 (24 residues), see Phobius details amino acids 397 to 419 (23 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 382 (356 residues), 202.6 bits, see alignment E=8.7e-64 PF00083: Sugar_tr" amino acids 56 to 196 (141 residues), 26.6 bits, see alignment E=2.8e-10

Best Hits

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 83% identity to psu:Psesu_2909)

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>ABIE51_RS03695 MFS transporter (Lysobacter sp. OAE881)
MNDTASQGVPTPTARVGKYRWRVCAMLLAATTINYVDRQVLGVLAPFLQTEIGWNEIEYG
YIVTSFQAAYAIGLLCTGAIIDRFGTRIGYAIAISVWSLAAMAHSLAGSVVGFAAARFAL
GLGEAGNFPAAIKTVAEWFPRRERALAVGVFNAGSNVGAVLAPLLVPIIAATWGWQAAFL
FTGVLSATWLAAWLLTYRTPDDQPKLTKAELDYIRSDPPEPTVKVPWLQLLRHRQAWAFV
AAKFITDPVWWLFLFWLGKFLASEYKLSLSTIGLPMIVVYLMADVGSIAGGWLAGRFMRM
GWDVNRARKGAMLTCALCVAPIVLVTQVDNLWIAVALIGLAMAGHQGWSANVFTLPSDMF
PRHAVASVVGIGGFAGAVGGMLMSVFTGAQLESTGSYARIFLIAGCAYLVALAVVHLLVP
KLQPAAFERAPAA