Protein Info for ABIE51_RS03580 in Lysobacter sp. OAE881

Annotation: YnfA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 32 to 52 (21 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details PF02694: UPF0060" amino acids 1 to 108 (108 residues), 119.4 bits, see alignment E=4.2e-39

Best Hits

Swiss-Prot: 69% identical to Y2004_NITHX: UPF0060 membrane protein Nham_2004 (Nham_2004) from Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)

KEGG orthology group: K09771, hypothetical protein (inferred from 68% identity to pbr:PB2503_12384)

Predicted SEED Role

"Protein of unknown function UPF0060"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (112 amino acids)

>ABIE51_RS03580 YnfA family protein (Lysobacter sp. OAE881)
MIRTTAVYIAAAFAEIAGCFGFWAWLRLAKTAWLVPLAMLSLATFAWLLTLVESSAAGRA
YAAYGGVYIAASLLWLWQVEGVKPDRWDVIGSIVCLIGAAIIVFAPRAPAVA