Protein Info for ABIE51_RS03265 in Lysobacter sp. OAE881

Annotation: trypsin-like peptidase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00089: Trypsin" amino acids 108 to 268 (161 residues), 66.9 bits, see alignment E=5.9e-22 PF13365: Trypsin_2" amino acids 109 to 244 (136 residues), 123.9 bits, see alignment E=2.3e-39 PF00595: PDZ" amino acids 287 to 365 (79 residues), 36.1 bits, see alignment E=1.8e-12 PF13180: PDZ_2" amino acids 288 to 378 (91 residues), 49.4 bits, see alignment E=1.2e-16 PF17820: PDZ_6" amino acids 313 to 367 (55 residues), 33.3 bits, see alignment 8.7e-12

Best Hits

KEGG orthology group: None (inferred from 67% identity to xal:XALc_0434)

Predicted SEED Role

"Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (477 amino acids)

>ABIE51_RS03265 trypsin-like peptidase domain-containing protein (Lysobacter sp. OAE881)
MRPLPTLLTLSLAAAFGGFAATAIRDGLEAPAQAAPASAVAATPTVATLPAVVGGQPLPS
LAPMLAKVTPAVVSVHTKQRVNVSPFGSDPMFRRMFPELTQERINESLGSGVIVDAKQGF
VLTNHHVIEGADEVSVTLADGRTLKADFVGSDPDTDVALMRIPAQGLTALPLADSSALRV
GDFVVAVGNPFGIGQTVTSGIVSAVGRSGLRGLGFQNFIQTDASINPGNSGGALVNLNGE
LVGINTASFNPRGSMAGNIGLGFAIPTSLARNIMGQLIANNGVVIRGTMGLESQDVDARL
AQALGLPEARGAVVTQVFSGGAAAAAGVKVGDVILAANGERIDDRDALRNFEGLQSVGSR
IALDVRRDGKPLTLTTTLREQPRSYVGTELDPRLTGASFADLPERLRQAGLSGVMVESVA
RGSRAEANGLRKDDVVIASNAGNFEDLPGFRASFTQRPAQLVLRILRGNRRADLLMQ