Protein Info for ABIE51_RS03240 in Lysobacter sp. OAE881

Annotation: HAD-IA family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF00702: Hydrolase" amino acids 5 to 193 (189 residues), 68.3 bits, see alignment E=1.9e-22 PF13419: HAD_2" amino acids 68 to 199 (132 residues), 44.2 bits, see alignment E=3.6e-15 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 93 to 193 (101 residues), 36.8 bits, see alignment E=5.2e-13 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 97 to 199 (103 residues), 33.3 bits, see alignment E=5.1e-12 PF13242: Hydrolase_like" amino acids 154 to 223 (70 residues), 42.8 bits, see alignment E=6.1e-15

Best Hits

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 62% identity to xac:XAC3986)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>ABIE51_RS03240 HAD-IA family hydrolase (Lysobacter sp. OAE881)
MAFPVRAITLDLDDTLWPFAPIGARVERVLHDWLTQHCPLTAQRFPIEAMRELRERMYVE
RPDLAHDFSQLRKLSLVRAMELAGDDPLHAEAAFEAFYDERNRVDFYEDTLDALARLAAR
VPLAAISNGNADLARVGIGAHFAFQLGAREHGMPKPHAGIFHAACARFPFAPHEVLHVGD
DIEMDVIGAHRAGLRSCWINRIGAQWPHEDVRPDLQFTTLAELADWLDSTHTMETVAA