Protein Info for ABIE51_RS03180 in Lysobacter sp. OAE881

Annotation: lipoyl synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF16881: LIAS_N
  • amino acids 46 to 84 (39 residues), 36.7 bits, 5e-13
• TIGR00510: lipoyl synthase
  • amino acids 46 to 330 (285 residues), 443.3 bits, E=2.2e-137
• PF04055: Radical_SAM
  • amino acids 99 to 265 (167 residues), 88.6 bits, E=5.4e-29

Best Hits

Swiss-Prot: 86% identical to LIPA_XANC8: Lipoyl synthase (lipA) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 86% identity to xca:xccb100_0745)

MetaCyc: 61% identical to lipoyl synthase (Escherichia coli K-12 substr. MG1655)
Lipoyl synthase. [EC: 2.8.1.8]

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

• lipoate biosynthesis and incorporation I (2/2 steps found)
• lipoate biosynthesis and incorporation III (Bacillus) (2/3 steps found)
• lipoate biosynthesis and incorporation V (mammals) (2/3 steps found)
• lipoate biosynthesis and incorporation IV (yeast) (4/7 steps found)
• lipoate biosynthesis and incorporation II (1/3 steps found)

KEGG Metabolic Maps

• Lipoic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.8

Protein Sequence (337 amino acids)

>ABIE51_RS03180 lipoyl synthase (Lysobacter sp. OAE881)
MSETASKTIPLSVVSGDAASSLQPGVKQIAGDKIARSPVQFADAPVLRKPSWIRVRIPSG
NSVQQLKSKLRENRLVTVCEEASCPNIHECFSHGTATFMILGEVCTRRCSFCDVAHGRPK
PPDPSEPLSLATTVADMGLKYVVVTSVDRDDLRDGGAQHFVDCIAAIREHSPRTRIEILT
PDFRGKGRMERALEIMAASPPDVFNHNVETVPDLYRNVRPGADYQWSLTLLKKFKAQHPE
VATKSGIMLGLGETMEQVQGTLRDLRDHDVDMITIGQYLQPSAHHHPVLRYWTPEEFKAL
EEYGYALGFTHVASGPLVRSSYHADRSAIEAGVVAAG