Protein Info for ABIE51_RS03045 in Lysobacter sp. OAE881

Annotation: ATP-dependent protease ATPase subunit HslU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 TIGR00390: ATP-dependent protease HslVU, ATPase subunit" amino acids 12 to 462 (451 residues), 667.7 bits, see alignment E=4.2e-205 PF07728: AAA_5" amino acids 60 to 96 (37 residues), 24.6 bits, see alignment 6.8e-09 PF00004: AAA" amino acids 61 to 114 (54 residues), 30.2 bits, see alignment 1.7e-10 amino acids 247 to 351 (105 residues), 31.3 bits, see alignment E=7.6e-11 PF07724: AAA_2" amino acids 207 to 348 (142 residues), 93.9 bits, see alignment E=3.5e-30

Best Hits

Swiss-Prot: 83% identical to HSLU_XANAC: ATP-dependent protease ATPase subunit HslU (hslU) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K03667, ATP-dependent HslUV protease ATP-binding subunit HslU (inferred from 83% identity to xac:XAC0638)

Predicted SEED Role

"ATP-dependent hsl protease ATP-binding subunit HslU" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>ABIE51_RS03045 ATP-dependent protease ATPase subunit HslU (Lysobacter sp. OAE881)
MPIKPDTSNATMTPREIVQELDRHIVGQHSAKRAVAIALRNRWRRMQLPAELRNEVMPKN
ILMIGPTGVGKTEIARRLATLANAPFVKVEATRFTEVGYVGKDVEQIVRDLADTAVKLYR
EQAKQRVRTQAEERAEERILDALLPRRQGAPTVFGFNATEEAKDEPSSQENETRAKLRKQ
LRTGALDDREIEIETAVNVGVDIMAPPGMEEMGQQLRQMFSQVAGAKTHKKTLPIRTART
QLTEEEAGKLVNEDEVREAAIEACEQHGIVFIDEIDKVAKRSEAGVTGGDVSREGVQRDL
LPLVEGSTVSTKYGPVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELSALSKDDFV
RILTEPKAALTTQYVELLRTEGVGLEFTADAVDRLAEIAAQVNERQENIGARRLHTVLER
LLDVLSYEAPDRDGQSVKIDRAYVDSHLGELVQDPDLSRYIL