Protein Info for ABIE51_RS03025 in Lysobacter sp. OAE881

Annotation: diaminopimelate epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00652: diaminopimelate epimerase
  • amino acids 4 to 278 (275 residues), 259.3 bits, E=2.1e-81
• PF01678: DAP_epimerase
  • amino acids 5 to 90 (86 residues), 65.3 bits, E=2.8e-22
  • amino acids 158 to 271 (114 residues), 107.1 bits, E=3.1e-35

Best Hits

Swiss-Prot: 66% identical to DAPF_XANAC: Diaminopimelate epimerase (dapF) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K01778, diaminopimelate epimerase [EC: 5.1.1.7] (inferred from 66% identity to xal:XALc_2577)

MetaCyc: 62% identical to O-ureido-serine racemase (Streptomyces lavendulae lavendulae)
RXN-14459 [EC: 5.1.1.19]

Predicted SEED Role

"Diaminopimelate epimerase (EC 5.1.1.7)" in subsystem Lysine Biosynthesis DAP Pathway (EC 5.1.1.7)

MetaCyc Pathways

• L-lysine biosynthesis I (8/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (14/18 steps found)
• aspartate superpathway (19/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (11/15 steps found)
• L-lysine biosynthesis VI (5/7 steps found)
• L-lysine biosynthesis II (6/9 steps found)
• D-cycloserine biosynthesis (3/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.19 or 5.1.1.7

Protein Sequence (281 amino acids)

>ABIE51_RS03025 diaminopimelate epimerase (Lysobacter sp. OAE881)
MTLRFTKMHGAGNDFVVLDLRADTAEPGAALCRAMADRHTGVGCDQILTVERAADGAAAR
YRIWNADGSSSQQCGNGARCIAAWIVRDAQARGEALGDEFVLDSPVGAHAVTRLEGGRYR
IEMGLPRFAPNSIPLHGFEGAQDEYVLYHNDAVFTFGAVSMGNPHAVIEVDDIDHAPVET
VGPMLQAHPAFPESVNVGFAQVQSRDRIRLRVYERGVGETLACGSGACAAAAVLMRRGRV
NRDVTVALPGGELRIAWPADDAPLTMSGPTAFVFEGEWNHE