Protein Info for ABIE51_RS02575 in Lysobacter sp. OAE881

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00529: CusB_dom_1" amino acids 19 to 341 (323 residues), 43.8 bits, see alignment E=5.1e-15 PF16576: HlyD_D23" amino acids 48 to 290 (243 residues), 65.2 bits, see alignment E=1.3e-21 PF13533: Biotin_lipoyl_2" amino acids 50 to 93 (44 residues), 52.9 bits, see alignment 6.3e-18 PF13437: HlyD_3" amino acids 215 to 299 (85 residues), 48 bits, see alignment E=4.5e-16

Best Hits

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 47% identity to rhi:NGR_b21350)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>ABIE51_RS02575 HlyD family secretion protein (Lysobacter sp. OAE881)
MKSRTATVIGLLVAVAATATATAVMRPGSVVQSWDRHYTDNAFVRGDITQISPKVSGHVA
RVLVKDNQSVKAGDLLFQIDDRDYRARATQARAVLSARQAAIGNLDAQLRLQHAAIEQAQ
ASVIEASAEAARSDRDSSRGRALAKDQLIAVSQLDELVSGAQVAATRVAEMRAALGAARE
RIGVLESQRPQLQADIRAAEAAVMLADLDVESTSVRAPVDGRVSERIARVGQYVRSGTPL
IALVASDVWVVANFKETQLDGMQPGEDVDVVVDAIPGETFHGRIDSLSPASGAQFALLPP
DNATGNFTRIAQRVPVRVALVDDGADVDRLRPGMSATVRVR