Protein Info for ABIE51_RS02520 in Lysobacter sp. OAE881

Annotation: cyclopropane-fatty-acyl-phospholipid synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 PF02353: CMAS" amino acids 136 to 404 (269 residues), 270.3 bits, see alignment E=3.6e-84 PF13489: Methyltransf_23" amino acids 190 to 306 (117 residues), 36.3 bits, see alignment E=9.6e-13 PF13649: Methyltransf_25" amino acids 196 to 290 (95 residues), 38.9 bits, see alignment E=2.3e-13 PF08241: Methyltransf_11" amino acids 197 to 292 (96 residues), 23 bits, see alignment E=2e-08

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 62% identity to smt:Smal_1954)

Predicted SEED Role

"S-adenosyl-L-methionine dependent methyltransferase, similar to cyclopropane-fatty-acyl-phospholipid synthase"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>ABIE51_RS02520 cyclopropane-fatty-acyl-phospholipid synthase family protein (Lysobacter sp. OAE881)
MSDTARQTLSLPDAGVVDRLLRDRVVSQLRALRSGAVTLRDPWGSAALGEHAGRAPSPTL
RVNDARFYRAVALGGSVGAAEAYMDGAWACDDLVGLVRLLVRNRDLLDDVERGPARVAGW
ALRAAHALRRNTASGARRNIAAHYDLGNTFFRLFLSDDLMYSSALFEREDDTLEDASTRK
LQAICRKLDLREGERVLEIGTGWGGFALHAAREHGCHVTTTTLSREQYELACQRVAEAGL
QDRVTVLMRDFRELDGTYDKLASIEMVEAIGPENLRRYFACIGERLADHGLALVQAITIE
DHRYEQAVRSVDFIKRHVFPGSFIPSIAAMMSAKTAASDLALLHLEDMGLSYARTLQTWR
ERFLDRLPEVRALGFDERFIRMWEFYLAYCEGGFRERSIGVAQMLFARPGFRPRAQAAVV
SET