Protein Info for ABIE51_RS02510 in Lysobacter sp. OAE881

Annotation: DUF1295 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details PF06966: DUF1295" amino acids 21 to 247 (227 residues), 227.7 bits, see alignment E=1.4e-71 PF02544: Steroid_dh" amino acids 138 to 200 (63 residues), 29.8 bits, see alignment E=5.5e-11

Best Hits

KEGG orthology group: None (inferred from 65% identity to sml:Smlt2369)

Predicted SEED Role

"FIG005069: Hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>ABIE51_RS02510 DUF1295 domain-containing protein (Lysobacter sp. OAE881)
MSTGASLLLVWALAALAQTLAWWWQQRHRNAGLVDVVWAGGVAGAAVLLAALGDGATMPR
LLLALLGGLWGLRLSWHLWRRVRGEHEDGRYAALRESWGDAPLRWFALFQAQALLVVLFA
LPFAAVASNRVESPGLLWAAVAVWIVSVVGETIADAQLARFRSQPENRGRTMRAGLWRYS
RHPNYFFEWLHWFAYVLLAVGSPIAWLAWSGPLTMYVFLRWLSGVPHTERQALRTRGDDY
RRYQRSTPMLFPWFPKEDR