Protein Info for ABIE51_RS02330 in Lysobacter sp. OAE881

Annotation: AGE family epimerase/isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 PF07221: GlcNAc_2-epim" amino acids 38 to 395 (358 residues), 403.4 bits, see alignment E=9.4e-125

Best Hits

KEGG orthology group: None (inferred from 76% identity to xcb:XC_2726)

Predicted SEED Role

"D-mannose isomerase (EC 5.3.1.7)" in subsystem Mannose Metabolism (EC 5.3.1.7)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>ABIE51_RS02330 AGE family epimerase/isomerase (Lysobacter sp. OAE881)
MTTLHTTEPDFRSDAFLRAHIADTMAFYHPRAIDPNGGFFHYFRDDGSVYDASHRHLVSS
TRFVFNYAMAAREFGNAEYLDAARHGLRYLRDVHRDASTGGYAWTIRDGVAEDRTNHCYG
VAFVLLAYSTALKAGIDEVVPWIDETWQLLESRFFDADAGLYRDEADAEWNFSDYRGQNA
NMHMCEAMLAAYEATKQTRFLDRALLLADGMTRRQAAKAGGLVWEHYDRDWNVDWDYHRD
DPKHLFRPWGYQPGHQTEWAKLLVILDGHLRERGTPADGLIETARHLFDTAVQRAWDAEF
GGLAYGFGLAPEFAVCDDDKYFWVQAESLAAAARLADAAGDVAYWDWYDRLWAYSWRHFV
DHEHGAWYRILDRRNRKYSDEKSPAGKTDYHTMGACYDVLAVLRHRGEN