Protein Info for ABIE51_RS02175 in Lysobacter sp. OAE881

Annotation: signal peptide peptidase SppA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 627 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details TIGR00705: signal peptide peptidase SppA, 67K type" amino acids 18 to 572 (555 residues), 515.3 bits, see alignment E=2e-158 PF01343: Peptidase_S49" amino acids 138 to 292 (155 residues), 79.5 bits, see alignment E=2.7e-26 amino acids 396 to 546 (151 residues), 151.6 bits, see alignment E=1.8e-48 TIGR00706: signal peptide peptidase SppA, 36K type" amino acids 355 to 542 (188 residues), 169 bits, see alignment E=1.1e-53 PF01972: SDH_sah" amino acids 357 to 435 (79 residues), 22.1 bits, see alignment E=6.9e-09

Best Hits

KEGG orthology group: K04773, protease IV [EC: 3.4.21.-] (inferred from 69% identity to sml:Smlt4190)

Predicted SEED Role

"protease IV"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (627 amino acids)

>ABIE51_RS02175 signal peptide peptidase SppA (Lysobacter sp. OAE881)
MNDMPRRGPIARFFVGVWDAMNFTRRLILNLLFLLLLFVFLAILMAGPRNKPLLDRTTLV
IAPEGNLVEQFSSDPLTRALERALGEKGGEVQLRDLVRALDAAAKDKRVERVVLNLDKLQ
AAGMASLRETAGAIARVKASGKQVVAFSEMMDQKQYLLASQASEVYLDPMGGMLLEGLGR
YRTYYREGLQDKLGVDVHLFKVGEYKSAAEPYVLDAASPEAKEADLYWMNDVWQRYLADV
AKARKLDAAKLSQQIDQMPEGIEAANGDLAKFAVATKLVDGLKTHEEVDDLLRQRGVADD
DAPGGYRQASFDEYLTQIDSGLSAVDPRPQVAVVVAEGEIRGGEQPPGTVGGVSTAELLR
EARDDDNVKAVVLRVDSPGGEVFASEQIRREIVGLKKAGKPVAVSMGDLAASGGYWISMD
ADRIYADASTITGSIGIFGLIPTIPRALEKIGVRSDGVGTTRFAGAFDITRPLQPEVGQV
IQSVIEKGYRDFTGRVATARKKPVEQVDAIARGRVWTGAQAKERGLVDELGGLHQAIEFA
AKRAELGQQGDYQVRYIEKAATPFERFFTGFIASRAGGALMRDSDLARSLIAKASPQTAK
DLRFLESSIAPTRGVPVKALAYCFCGF