Protein Info for ABIE51_RS02090 in Lysobacter sp. OAE881

Annotation: permease-like cell division protein FtsX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 43 to 65 (23 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 287 to 310 (24 residues), see Phobius details PF18075: FtsX_ECD" amino acids 80 to 168 (89 residues), 43.4 bits, see alignment E=4.4e-15 PF02687: FtsX" amino acids 191 to 311 (121 residues), 50.5 bits, see alignment E=2e-17

Best Hits

Swiss-Prot: 40% identical to FTSX_PSEPU: Cell division protein FtsX (ftsX) from Pseudomonas putida

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 62% identity to xal:XALc_2878)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>ABIE51_RS02090 permease-like cell division protein FtsX (Lysobacter sp. OAE881)
MSAPTANASTRPARPNSRLGTWFDHHVYSLVASVGRMLRKPWATALTIGVMAVAITLPLG
LWAALGNVERFTGTVEQSRQISLFLKPQVTVDRARALAEQLRGRGDIATLDLRTPEQGME
ELRRSSGLGEAISAVDGNPLPSVLVVTPKGDETTLAESLRTLPDVDVVQHDAAWRQRLDQ
WLRFGVRLAWVLAALLGVGALLVVGNTVRLDIQSRRDEIAVLQQLGATDGFIRRPFLYLG
LSYGLAAGLIALGLLTAADRALREPLAALAQSYGSQFALHGFDLLDAVAIVIGSGVLGWI
GAGLVAGHYLRQTRPTT