Protein Info for ABIE51_RS02080 in Lysobacter sp. OAE881

Annotation: ATP-dependent RNA helicase RhlB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 PF00270: DEAD" amino acids 33 to 206 (174 residues), 157.8 bits, see alignment E=4.2e-50 PF00271: Helicase_C" amino acids 244 to 352 (109 residues), 104.9 bits, see alignment E=5.8e-34 PF12300: RhlB" amino acids 377 to 549 (173 residues), 108.6 bits, see alignment E=9.2e-35

Best Hits

Swiss-Prot: 78% identical to RHLB_XANC5: ATP-dependent RNA helicase RhlB (rhlB) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K03732, ATP-dependent RNA helicase RhlB [EC: 3.6.4.13] (inferred from 77% identity to psu:Psesu_2776)

Predicted SEED Role

"ATP-dependent RNA helicase RhlB" in subsystem ATP-dependent RNA helicases, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (576 amino acids)

>ABIE51_RS02080 ATP-dependent RNA helicase RhlB (Lysobacter sp. OAE881)
MSDKPLTDVSFSSFDLHPSLLAGLEAAGFTRCTPIQALTLPIALQGRDVAGQAQTGTGKT
LAFLVAVMNRLLTRPALAERKPEDPRALILAPTRELAIQIHKDAVKFGSDLGLKFALVYG
GVDYDKQRELLQKGADIIIATPGRLIDYVKQHKVVSLHACEICVLDEADRMFDLGFIKDI
RFLLRRMPIRTERQTLLFSATLSHRVLELAYEHMNEPEKLVVEAETVTAARVRQKVFFPA
DDEKIPLLLGLLSRSEGARTMVFVNTKAFVERVARALEKGGYRVGVLSGDVPQKKRETLL
NRFQKGQLEILVATDVAARGLHIDGVSHVYNYDLPFDAEDYVHRIGRTARLGAEGDAISF
ACERYAMSLPDIEAYIEQKLPVAAVEADMLVAIPRPPREVPEGAEGEGENESIGSIFKEA
REQRAADEERRGGGRSRGGKPGGGRSEGRREGGRREGGRAEGREGAPRGERKPRPQPVVD
AAAQAHQAVEAATPPTGDAERAPRKRRRRRGGRRIEGAEAATQAAAPAQAAPKSPTQVHA
QKAAKAAAKDGDKLGLLHRIGRGLKSLISRSPRSQH