Protein Info for ABIE51_RS02060 in Lysobacter sp. OAE881

Annotation: monovalent cation:proton antiporter-2 (CPA2) family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 49 (20 residues), see Phobius details amino acids 55 to 74 (20 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details amino acids 213 to 231 (19 residues), see Phobius details amino acids 237 to 254 (18 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 292 to 313 (22 residues), see Phobius details amino acids 324 to 343 (20 residues), see Phobius details amino acids 359 to 381 (23 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 10 to 373 (364 residues), 207.6 bits, see alignment E=2.9e-65 TIGR00932: transporter, monovalent cation:proton antiporter-2 (CPA2) family" amino acids 13 to 283 (271 residues), 255.5 bits, see alignment E=3.3e-80 PF02254: TrkA_N" amino acids 402 to 513 (112 residues), 85.8 bits, see alignment E=2.9e-28

Best Hits

KEGG orthology group: K11747, glutathione-regulated potassium-efflux system protein KefB (inferred from 63% identity to sml:Smlt4552)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (609 amino acids)

>ABIE51_RS02060 monovalent cation:proton antiporter-2 (CPA2) family protein (Lysobacter sp. OAE881)
MHGGGLELALVFLLAAVIAVPVFRRFGLGAVLGYLAAGVTLGPYGLRFVANAEPVLTAAE
IGVVMLLFVIGLELSPARLRVMRKPIFGAGGAQVALSALAIGAAAMIAGTSWQAALVIGM
GLAFSSTAIGLQLLSERKAMTTDHGRLGFAILLFQDLAAIPLLAAIPLLGRAGAADNLGW
DEVAKALGAIAVVVIGGRFALRQVFRIIARVQMPEVFTGAALLVVLGTAWIMQGAGLSAG
LGAFLAGVLLADSEFRHELEAQIDPFKGLLLGLFFMAVGMSIDLDRVLSEPVLITGLAIA
LLMVKFSILYFVGRIPGGLDTRESLRLGAVLALGGEFAFVIFNEAVKSGLIDDPTRDRLV
AAVGISMALTPLLVIAIARLLSATPRKQERAFDTIPNDQPEVLIAGFGRFGQIVARLLLA
QHTRFIAIEHSADQVDFVRRFGNPVYYGDPAKPELLRSCGADQVKVFVVAIDGVEESLRT
VETMRRMYPDATIFARARDRRHAWELMDLGARAIRETFYSSLKMGEKVLVELGIAEDVAR
SHAEQFRDHDLRLLHAQSLIRDDEDALLQSTQDARRELEELFNADSGTGVLNEIADATRK
DMASVDEEE