Protein Info for ABIE51_RS01805 in Lysobacter sp. OAE881

Annotation: MoxR family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF20030: bpMoxR" amino acids 25 to 209 (185 residues), 40.2 bits, see alignment E=5.1e-14 PF07726: AAA_3" amino acids 52 to 182 (131 residues), 213.8 bits, see alignment E=1.7e-67 PF07728: AAA_5" amino acids 52 to 180 (129 residues), 44.6 bits, see alignment E=3.6e-15 PF00004: AAA" amino acids 53 to 162 (110 residues), 23.3 bits, see alignment E=1.9e-08 PF17863: AAA_lid_2" amino acids 250 to 320 (71 residues), 78.4 bits, see alignment E=6.8e-26

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 78% identity to psu:Psesu_2837)

Predicted SEED Role

"MoxR-like ATPases"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>ABIE51_RS01805 MoxR family ATPase (Lysobacter sp. OAE881)
MNADAAPAPLVPISGEALAARAAAVRGEVGKAFIGQEAVLDQILIALLAGGHVLIEGVPG
LGKTLLVRALSRAIDCSFARVQFTPDLMPSDISGHAVWNPKTETFNIRRGPVFTNLLLAD
EINRAPAKTQSALLEAMQELQVTIEGHSFQLTPPFLTLATQNPVEQEGTYPLPEAQLDRF
LLKVLIGYPTRADEKRMVAAVSQGRAASDFDLSQVARVLGPQEIVAMQAGTALVAVDDAV
IDYAVRIVAATRDWAGISLGAGPRGSLALVRAARAQAVLSGRDFVTPDDVREIAKPALRH
RIALAPELQIEGQSPDDVLHALLAKVEAPRK