Protein Info for ABIE51_RS01620 in Lysobacter sp. OAE881

Annotation: glucose-6-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00871: glucose-6-phosphate dehydrogenase
  • amino acids 4 to 479 (476 residues), 583.2 bits, E=2.1e-179
• PF00479: G6PD_N
  • amino acids 7 to 181 (175 residues), 187.7 bits, E=3.3e-59
• PF02781: G6PD_C
  • amino acids 184 to 478 (295 residues), 411.8 bits, E=1.4e-127

Best Hits

Swiss-Prot: 62% identical to G6PD_RHIME: Glucose-6-phosphate 1-dehydrogenase (zwf) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 64% identity to bid:Bind_2867)

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• pentose phosphate pathway (8/8 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• L-lysine biosynthesis I (8/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (14/18 steps found)
• aspartate superpathway (19/25 steps found)
• pentose phosphate pathway (oxidative branch) I (3/3 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (11/15 steps found)
• L-lysine biosynthesis VI (5/7 steps found)
• L-lysine biosynthesis II (6/9 steps found)
• cytosolic NADPH production (yeast) (3/5 steps found)
• heterolactic fermentation (12/18 steps found)
• formaldehyde oxidation I (3/6 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (4/8 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Glutathione metabolism
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.49

Protein Sequence (482 amino acids)

>ABIE51_RS01620 glucose-6-phosphate dehydrogenase (Lysobacter sp. OAE881)
MAPFDLIIFGGTGDLALRKLLPALFHRYVDGQIVAGTRIFGLARDSQTDEAYRERVREAL
QKHLAFDMRAPSMLEPFLQLLSYRRIDLQAEDGWGELAAELADESRVRVFYLAVGPDLFG
SVGAKLQAHGLTGANTRVVVEKPIGHDRASAAAINDALGQVFAESQIYRIDHYLGKETVQ
NLTALRFGNALFEPLWRAEHIDHVQITVAETVGLERRASYYDKSGALRDMVQNHMLQLLC
LVAMEPPSSLAADAIRDEKLKVLHSLKPIADGATSHLTVRGQYRAGAVEGRPVPGYLEEL
GTNTSRTETFVALKAEVSNWRWAGVPFYLRTGKRLADRMSEIVLTFRKVPHSIFGDEPVA
QNQLVIRLQPDEGVKLWIVNKIPGPGGLRLRRVPMDLSFAETFGGRQPEAYERLLMDVVR
GNPMLFMRRDEVEAAWSWIDPILAAWQSSNESPKAYTAGSWGPSAAVALIERDGRTWHED
AV