Protein Info for ABIE51_RS01430 in Lysobacter sp. OAE881

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 90 to 121 (32 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 159 to 183 (25 residues), see Phobius details amino acids 204 to 228 (25 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details amino acids 364 to 386 (23 residues), see Phobius details amino acids 407 to 426 (20 residues), see Phobius details amino acids 433 to 450 (18 residues), see Phobius details PF13520: AA_permease_2" amino acids 21 to 439 (419 residues), 145.4 bits, see alignment E=2.5e-46 PF00324: AA_permease" amino acids 23 to 423 (401 residues), 329.8 bits, see alignment E=2.7e-102

Best Hits

Swiss-Prot: 49% identical to AROP_CORGL: Aromatic amino acid transport protein AroP (aroP) from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 82% identity to smt:Smal_3002)

MetaCyc: 40% identical to 4-aminobutanoate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-384; TRANS-RXN-57

Predicted SEED Role

"amino acid transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>ABIE51_RS01430 amino acid permease (Lysobacter sp. OAE881)
MSTTDVSPAAAPQLGHALKPRQLIMMGLGSAIGAGLFLGSGVGVQAAGPAVLISYLVAGA
LVIIVMNALGEMAAAKPASGAFSVYAADAMGATAGATVGWLWWAQLVIVIAAESVGAAGL
LATVWPQIPVPLSSLTFMLVFTAINLMGVRNFGEFEFWFAILKVVAILLFIVIGAALLLG
LLPGVASPGLSNVTGHGGFAPKGWAGIGAALLVVVFAFGGTEIVAVAAAETSDPSRSLAR
AIRTVAWRILVFYIGSISVIIAVVPWTSESLRSPFAAVLEVARIPYASTTITLIAVIALL
SALNANLYGASRMIFSLAQREEAPRWLARVNRRQVPVIAVLSCVVFGFVATVFELWYPNR
VLPVLLNIVGSTCLLVWTISLVSQLILRRRADRAGSPLPFRMRGFPWLTVSALAILALIF
ALLVSSAETRGQFLSMAALTAGIALASELARRYRNSKRAQ