Protein Info for ABIE51_RS01360 in Lysobacter sp. OAE881

Annotation: nitrogen regulation protein NR(I)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 PF00072: Response_reg" amino acids 11 to 119 (109 residues), 93.3 bits, see alignment E=2.8e-30 TIGR01818: nitrogen regulation protein NR(I)" amino acids 11 to 470 (460 residues), 686 bits, see alignment E=1.3e-210 PF00158: Sigma54_activat" amino acids 146 to 312 (167 residues), 233.6 bits, see alignment E=2.8e-73 PF14532: Sigma54_activ_2" amino acids 147 to 317 (171 residues), 83.9 bits, see alignment E=3.3e-27 PF07728: AAA_5" amino acids 170 to 288 (119 residues), 26 bits, see alignment E=2.1e-09 PF02954: HTH_8" amino acids 433 to 469 (37 residues), 45.3 bits, see alignment 1.4e-15

Best Hits

Swiss-Prot: 54% identical to NTRC_KLEPN: DNA-binding transcriptional regulator NtrC (ntrC) from Klebsiella pneumoniae

KEGG orthology group: K07712, two-component system, NtrC family, nitrogen regulation response regulator GlnG (inferred from 75% identity to psu:Psesu_0094)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (477 amino acids)

>ABIE51_RS01360 nitrogen regulation protein NR(I) (Lysobacter sp. OAE881)
MKPHDTSDARVWVVDDDRSVRFVLATALREAGYRVDGFENARDALDALAERGAPDLLFTD
VRMPGDDGLVLLDKLKAQAPKLPVIVMSAYTDVASTAGAFRGGAHEFLSKPFDLDEAVEL
AARTLAAREATEPPQRDTAATQDDALIGEAPAMRTLFRAIGRLAQAPLSVLITGETGTGK
ELVARALHRESPRAQAPFVALNTAAIPAELLESELFGHEAGAFTGAQRRHVGRFEQAHGG
TLFLDEIGDMPLPLQTRLLRVLAEGEFFRVGGRELIRVDVRVIAATHQDLEGLVEAGRFR
ADLLHRLDVVRLRLPALRERREDVPRLAERFLRAAATRFDAPAKRLAPAAIERLVAYDWP
GNVRQLENLCWRLAALAPGDTIKREDLDEALAATPGKDDAQAAGDDDWDRRLAAWARAQL
ELGRDDIHAQARDRFERALFDAALEHTGGRRTEAAARLGLGRNTLTRKLGPGRRRPS