Protein Info for ABIE51_RS01190 in Lysobacter sp. OAE881

Annotation: pyridoxal-phosphate dependent enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00291: PALP
  • amino acids 22 to 309 (288 residues), 259.5 bits, E=2.2e-81

Best Hits

Swiss-Prot: 49% identical to SRR_DICDI: Probable serine racemase (srr) from Dictyostelium discoideum

KEGG orthology group: K01754, threonine dehydratase [EC: 4.3.1.19] (inferred from 70% identity to xcb:XC_0391)

MetaCyc: 44% identical to serine racemase/D-serine ammonia-lyase (Hordeum vulgare)
Amino-acid racemase. [EC: 5.1.1.10, 5.1.1.18]; D-serine ammonia-lyase. [EC: 5.1.1.10, 5.1.1.18, 4.3.1.18]

Predicted SEED Role

"Threonine dehydratase, catabolic (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis or Glycine and Serine Utilization or Threonine anaerobic catabolism gene cluster or Threonine degradation (EC 4.3.1.19)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (7/7 steps found)
• D-serine degradation (3/3 steps found)
• L-cysteine degradation II (3/3 steps found)
• L-serine degradation (3/3 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• alanine racemization (1/1 steps found)
• serine racemization (1/1 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (11/15 steps found)
• L-methionine degradation II (2/3 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• vancomycin resistance II (2/3 steps found)
• L-methionine biosynthesis II (4/6 steps found)
• L-alanine degradation I (1/2 steps found)
• L-threonine degradation V (1/2 steps found)
• superpathway of L-threonine metabolism (12/18 steps found)
• glycine betaine degradation III (4/7 steps found)
• L-threonine degradation I (3/6 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glycine betaine degradation I (4/8 steps found)
• purine nucleobases degradation II (anaerobic) (15/24 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)
• ansatrienin biosynthesis (1/9 steps found)
• hypoglycin biosynthesis (4/14 steps found)
• cyclosporin A biosynthesis (2/15 steps found)
• superpathway of L-lysine degradation (6/43 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• D-Arginine and D-ornithine metabolism
• D-Glutamine and D-glutamate metabolism
• Glycine, serine and threonine metabolism
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.19

Use Curated BLAST to search for 4.3.1.18 or 4.3.1.19 or 5.1.1.10 or 5.1.1.18

Protein Sequence (324 amino acids)

>ABIE51_RS01190 pyridoxal-phosphate dependent enzyme (Lysobacter sp. OAE881)
MNDIAHVTPTFEGVLAAAARIAPHAHATPVLRSRTLDALAGCELHLKAEHLQRAGAFKFR
GACNAIWSLDEATAARGVVTHSSGNHGAALALAARTRGVACHVVVPEGAVAAKLAAIEAY
GATLHRCAPTIAAREARTAELQAQLGAELVHPYTDPRVIAGQGTAALELLCTPERFDAIV
VPVGGGGLASGTALSVAARSPGTRLYLAEPAGAAETFASLAKGERVTDFTPDTVCDGLRG
TLGEINFRMLRDHGAQVLTVDDVDTVAAMRLFWQRTKQIVEPSSAVALAAALKHGPLFAG
QRVGVVLSGGNVDPDALPALFARA