Protein Info for ABIE51_RS00905 in Lysobacter sp. OAE881

Annotation: response regulator transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00072: Response_reg
  • amino acids 6 to 116 (111 residues), 102.1 bits, E=2.1e-33
• PF00196: GerE
  • amino acids 150 to 203 (54 residues), 61.9 bits, E=3.3e-21

Best Hits

Swiss-Prot: 38% identical to YXJL_BACSU: Uncharacterized transcriptional regulatory protein YxjL (yxjL) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 80% identity to xcb:XC_0114)

MetaCyc: 34% identical to DNA-binding transcriptional dual regulator NarL (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Two-component system regulatory protein"

Protein Sequence (210 amino acids)

>ABIE51_RS00905 response regulator transcription factor (Lysobacter sp. OAE881)
MTSLRIALADDQAIVRAGLRALLERHGIAIAFEANDGTELLERLAESPVDVVLSDIRMAG
MDGIEALRRLRERGDTTPVLLLTTFDESELLLQATEAGAQGFLLKDAAPEDLREAIARVA
AGETLLQPVSTDPVRARYQYHQQEAPREHFTEREVAILRLLAGGYSNKEIARAMFLAEGT
VKNYVSVILEKLGTRDRTRAVLKAITLRVI