Protein Info for ABIE51_RS00515 in Lysobacter sp. OAE881

Annotation: NADPH-dependent 7-cyano-7-deazaguanine reductase QueF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 TIGR03138: queuine synthase" amino acids 3 to 273 (271 residues), 361.9 bits, see alignment E=1.3e-112 PF14819: QueF_N" amino acids 13 to 122 (110 residues), 146.2 bits, see alignment E=4.7e-47 PF14489: QueF" amino acids 186 to 259 (74 residues), 76.5 bits, see alignment E=1.5e-25

Best Hits

Swiss-Prot: 64% identical to QUEF_STRM5: NADPH-dependent 7-cyano-7-deazaguanine reductase (queF) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K06879, 7-cyano-7-deazaguanine reductase [EC: 1.7.1.13] (inferred from 64% identity to smt:Smal_3687)

Predicted SEED Role

"NADPH dependent preQ0 reductase (EC 1.7.1.13)" (EC 1.7.1.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>ABIE51_RS00515 NADPH-dependent 7-cyano-7-deazaguanine reductase QueF (Lysobacter sp. OAE881)
MTHDLPLGRHVDYPREYDASLLFPIARSLGRDHIGIASGELPFIGVDRWNAYELSWLDRR
GKPRVGTATITVPATSPNLVESKSLKLYLNSFNAARFDSDAEVHARIVEDLTRVAGAPVD
VRFGLPPIDEAAPDNAVLDCIDSLDVEIDDYGPPNADHLSADASRVVTETLTSSLLKSNC
PVTGQPDWARIVIDYHGPKLDRAGLLRYLVSFRDHAEFHEQCVERVFVDLLAHTRAQRLS
VEARYTRRGGLDINPWRATPGIERPAPGRDERQ