Protein Info for ABIE51_RS00260 in Lysobacter sp. OAE881

Annotation: alpha/beta fold hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00561: Abhydrolase_1
  • amino acids 37 to 282 (246 residues), 93.2 bits, E=2.2e-30
• PF12697: Abhydrolase_6
  • amino acids 38 to 282 (245 residues), 58.3 bits, E=1.8e-19

Best Hits

Swiss-Prot: 67% identical to OLEB_XANCP: Cis-3-alkyl-4-alkyloxetan-2-one decarboxylase (oleB) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K01563, haloalkane dehalogenase [EC: 3.8.1.5] (inferred from 69% identity to sml:Smlt0206)

MetaCyc: 67% identical to 3-alkyl-4-alkyloxetan-2-one decarboxylase monomer (Xanthomonas campestris)
RXN-18558 [EC: 4.1.1.114]

Predicted SEED Role

"Haloalkane dehalogenase-like protein"

MetaCyc Pathways

• cis-alkene biosynthesis (3/4 steps found)
• 1,2-dichloroethane degradation (1/4 steps found)
• γ-hexachlorocyclohexane degradation (5/11 steps found)

KEGG Metabolic Maps

• 1,2-Dichloroethane degradation
• 3-Chloroacrylic acid degradation
• Naphthalene and anthracene degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.8.1.5 or 4.1.1.114

Protein Sequence (299 amino acids)

>ABIE51_RS00260 alpha/beta fold hydrolase (Lysobacter sp. OAE881)
MTIHLPLPDYPFTPQRFDVRPGIAMSYLDEGPRDGEVVVMLHGNPSWSFYWRKLVLGLRD
RYRCIVPDHVGMGLSDKPSDDRYRYTLQSRIDDVETLLDRLGIEGDVTLAVHDWGGGIGF
GWGLKHASRIRRLIVTNTGSFPLPASKPLPKSLKFGRDSGLGTLLIRGVNAFSSVASYVG
VENRMPADVRRAYVAPYDTWANRIATSRFVQDIPLGEGDAAWPLVQAMGRKLPEYADRPA
FIAWGLRDFVFDKHFLKGFTDALPNAQVHAFEDAGHYVLEDKVDVLVPKMRAFLDANPL