Protein Info for ABIE51_RS00115 in Lysobacter sp. OAE881

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02826: 2-Hacid_dh_C
  • amino acids 4 to 98 (95 residues), 27.9 bits, E=3.7e-10
• PF01488: Shikimate_DH
  • amino acids 5 to 80 (76 residues), 27.1 bits, E=1e-09
• PF03807: F420_oxidored
  • amino acids 9 to 97 (89 residues), 40 bits, E=1.3e-13
• PF03446: NAD_binding_2
  • amino acids 9 to 165 (157 residues), 150.6 bits, E=1e-47
• PF14833: NAD_binding_11
  • amino acids 168 to 286 (119 residues), 107.8 bits, E=1.1e-34

Best Hits

Swiss-Prot: 37% identical to Y229_SYNY3: Uncharacterized oxidoreductase slr0229 (slr0229) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K00020, 3-hydroxyisobutyrate dehydrogenase [EC: 1.1.1.31] (inferred from 55% identity to nhl:Nhal_1873)

Predicted SEED Role

"2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Photorespiration (oxidative C2 cycle) (EC 1.1.1.60)

MetaCyc Pathways

• glycolate and glyoxylate degradation I (2/4 steps found)
• superpathway of glycol metabolism and degradation (4/7 steps found)
• D-glucarate degradation I (1/4 steps found)
• D-galactarate degradation I (1/4 steps found)
• superpathway of D-glucarate and D-galactarate degradation (1/5 steps found)
• L-valine degradation I (3/8 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (11/31 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.31 or 1.1.1.60

Protein Sequence (291 amino acids)

>ABIE51_RS00115 NAD(P)-dependent oxidoreductase (Lysobacter sp. OAE881)
MNQRNKQMKVGFIGLGAMGAPMARYVHAKGLLTAVGNRTQAKADALAAELNVRAARSGAN
FADCDVVVLCVSLDADVLENVAALADVLKPGAIVIDHSTVAVDTARRCAAQLAQHNIGFL
DAPVSGGVEGARNGKLSVMVGGDADVLEVARPVIESYAARISHMGATGAGQATKAVNQVL
VAGINEAVCEGLALGEKLGLDPEKLLPTLLAGAANNWFLDKRGATMLRDEFNPGFKCAHM
LKDLRIVAAIARDTGVRMSTVEQALADYAELIERGQGESDTSALITLKRGG