Protein Info for ABCV34_RS15885 in Castellaniella sp019104865 MT123
Annotation: DNA repair protein RadC
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 59% identical to Y1786_VIBCH: UPF0758 protein VC_1786 (VC_1786) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
KEGG orthology group: K03630, DNA repair protein RadC (inferred from 94% identity to pna:Pnap_4157)Predicted SEED Role
"DNA repair protein RadC" in subsystem DNA repair, bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (168 amino acids)
>ABCV34_RS15885 DNA repair protein RadC (Castellaniella sp019104865 MT123) MSQLSFSLDSSLLVRDITGDYRPANADEVLQAAQRLLGAQLRGREVLSSPQTVRDFLRVK LGGLEHEVFAVLMLDAQNRLIEYVELFRGTVSQASVYPREVVKESLGFNAAAAIFCHNHP SGVAEPSRADEMLTQTLKTALSLVDVRVLDHLIVAGNDVMSFAERGLL