Protein Info for ABCV34_RS15565 in Castellaniella sp019104865 MT123

Annotation: phosphoglucosamine mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 4 to 139 (136 residues), 152.4 bits, E=1.3e-48
• TIGR01455: phosphoglucosamine mutase
  • amino acids 7 to 442 (436 residues), 571.2 bits, E=7e-176
• PF02879: PGM_PMM_II
  • amino acids 161 to 258 (98 residues), 69.2 bits, E=8.2e-23
• PF02880: PGM_PMM_III
  • amino acids 262 to 369 (108 residues), 106.9 bits, E=1.3e-34
• PF00408: PGM_PMM_IV
  • amino acids 376 to 441 (66 residues), 53.1 bits, E=5.4e-18

Best Hits

Swiss-Prot: 74% identical to GLMM_BORPD: Phosphoglucosamine mutase (glmM) from Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 75% identity to put:PT7_0113)

MetaCyc: 59% identical to phosphoglucosamine mutase (Escherichia coli K-12 substr. MG1655)
Phosphoglucosamine mutase. [EC: 5.4.2.10]

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• colanic acid building blocks biosynthesis (10/11 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• peptidoglycan recycling I (10/14 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (3/5 steps found)
• sucrose degradation II (sucrose synthase) (3/5 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (2/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (2/4 steps found)
• GDP-α-D-glucose biosynthesis (1/3 steps found)
• trehalose degradation V (1/3 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• glucose and glucose-1-phosphate degradation (2/5 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• starch degradation III (1/4 steps found)
• starch degradation V (1/4 steps found)
• chitin biosynthesis (4/9 steps found)
• sucrose biosynthesis II (3/8 steps found)
• glycogen degradation II (1/6 steps found)
• starch biosynthesis (3/10 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (1/8 steps found)
• glycogen degradation I (1/8 steps found)
• CMP-legionaminate biosynthesis I (2/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (7/24 steps found)
• streptomycin biosynthesis (2/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.10

Protein Sequence (446 amino acids)

>ABCV34_RS15565 phosphoglucosamine mutase (Castellaniella sp019104865 MT123)
MTARRYFGTDGVRGIVGGDRINAEFALRLGYAAGRVLAQDAVTTGRPTVVIGKDTRISGY
MLESALEAGLSAAGVDVLLAGPIPTPAVAYLTRAWRLAAGIVISASHNPHYDNGIKFFSS
AGAKLPDETEAAIEAMIEQPVGCADSAGLGRARRISDAAGRYIEFCKSTFPNELDLQGLK
IVVDAANGAAYHIAPHVFRELGADVSVIGCEPDGFNINEKVGATHPETLVAAVAAQGADL
GIALDGDADRLQMVDATGRLYNGDELLYAIVRDRARTQPIDGVVGTLMTNYGFERRMIEL
GIPFERARVGDRYVLELLHQHGWLFGGESSGHLLCLDRHTTGDGIVAALQVLAAIRHARA
PLADLVADLTMYAQKMVNVPLAPGLDWQSHAGLQAASRAVRTTLGDRGRVLIRASGTEPK
LRLMVEADDPALAEEGVRQLVAVKLT