Protein Info for ABCV34_RS15515 in Castellaniella sp019104865 MT123

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF08659: KR" amino acids 25 to 188 (164 residues), 33.7 bits, see alignment E=5.1e-12 PF00106: adh_short" amino acids 27 to 211 (185 residues), 132.8 bits, see alignment E=1.7e-42 PF13561: adh_short_C2" amino acids 31 to 212 (182 residues), 88.6 bits, see alignment E=7.6e-29

Best Hits

KEGG orthology group: None (inferred from 69% identity to put:PT7_0101)

Predicted SEED Role

"Oxidoreductase, short-chain dehydrogenase/reductase family (EC 1.1.1.-)" (EC 1.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>ABCV34_RS15515 SDR family oxidoreductase (Castellaniella sp019104865 MT123)
MTSAAPAASREPRAASSPVPADRPGRVFVTGASSGIGAALARQYAARGAVLGLVGRRRDA
LQALCDSLPGQDHRMYVLDVRDRPALQAAARDFLAGGPVDRVIASAGISAGTLAGEPEDF
AVFQDIFDTNVLAMVSTFEPFIAPMRECRQGVLVGIGSVAGVRGLPGAGAYSGSKAAVRA
LCESLRVELHGTGVRVVTLAPGFIATPMTAHNPYRMPFLMPVDRFAEQAVRAIEAGDRYR
VIPWPMAWVARLLRMVPDVIYDAVAARRKRKPRRGGSSE