Protein Info for ABCV34_RS15505 in Castellaniella sp019104865 MT123

Annotation: glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF00988: CPSase_sm_chain" amino acids 1 to 124 (124 residues), 175.8 bits, see alignment E=4.8e-56 TIGR01368: carbamoyl-phosphate synthase, small subunit" amino acids 2 to 362 (361 residues), 457.3 bits, see alignment E=1.7e-141 PF00117: GATase" amino acids 183 to 359 (177 residues), 168.2 bits, see alignment E=2.6e-53 PF07722: Peptidase_C26" amino acids 237 to 275 (39 residues), 23.9 bits, see alignment 5e-09

Best Hits

Swiss-Prot: 68% identical to CARA_RALSO: Carbamoyl-phosphate synthase small chain (carA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01956, carbamoyl-phosphate synthase small subunit [EC: 6.3.5.5] (inferred from 80% identity to put:PT7_0099)

MetaCyc: 61% identical to carbamoyl-phosphate synthetase small subunit (Escherichia coli K-12 substr. MG1655)
Carbamoyl-phosphate synthase (glutamine-hydrolyzing). [EC: 6.3.5.5]

Predicted SEED Role

"Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)" in subsystem De Novo Pyrimidine Synthesis or Macromolecular synthesis operon (EC 6.3.5.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.5

Use Curated BLAST to search for 6.3.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>ABCV34_RS15505 glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit (Castellaniella sp019104865 MT123)
MADGTVFRGVSIGADGFTVAEIVFNTAMTGYQEILTDPSYSGQIVTLTYPHIGNTGVNAE
DVESSQIHAAGLVVRDCPARVSNFRATQSLPDYLKSQGIVAISGVDTRKLTRILRERGAQ
GACILVGEDVERAVELARGFGGMEGQDLALKVTTSKPGAWVQGTWQLGRGFRRQDQADYN
VVAYDYGIKTNILRLLADRGCRITLVPATTPVADILAQNPDGVFLSNGPGDPAACQYAVD
TCKAVLDRGIPLFGICLGQQVLGLTLGGRTVKMKTGHHGANHPVQDLATGRVFITSQNHG
FTVDGASLPANARVTHVSLFDGTLQGFELTDKPVFCFQGHPEASPGPHDILVLFDKFIDL
MAQHKAQSSK