Protein Info for ABCV34_RS15495 in Castellaniella sp019104865 MT123

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 41 to 54 (14 residues), see Phobius details amino acids 65 to 89 (25 residues), see Phobius details amino acids 111 to 144 (34 residues), see Phobius details amino acids 168 to 185 (18 residues), see Phobius details amino acids 189 to 213 (25 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 80 to 249 (170 residues), 96.6 bits, see alignment E=7.8e-32

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 81% identity to put:PT7_0095)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>ABCV34_RS15495 ABC transporter permease (Castellaniella sp019104865 MT123)
MKSELSRPVLRSLQLALLVAIVLVWHWASTNQNVAFFFGRPVEVAQVIWAWFVTDASVYR
HLWITLSETVLAFIIGTVGGLACGLWLGLSRSASALLEPYVTAANSMPRVILAPIFGMWF
GLGIWSKVALAVTLVFFIVFFNVYRGVREVSPTLLDNARMLGATRRQLLRSVYIPSATSW
VFSSLHTSVGLAFVGAVVGEYLGSAAGVGYLILQAEGTLDVNTVFAGIVVLTIFALLLDG
AVSLGERRLLVWQPGPGESGKT