Protein Info for ABCV34_RS15365 in Castellaniella sp019104865 MT123

Annotation: tRNA guanosine(34) transglycosylase Tgt

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 TIGR00430: tRNA-guanine transglycosylase" amino acids 6 to 371 (366 residues), 538.6 bits, see alignment E=7.3e-166 TIGR00449: tRNA-guanine family transglycosylase" amino acids 6 to 372 (367 residues), 518 bits, see alignment E=1.2e-159 PF01702: TGT" amino acids 13 to 374 (362 residues), 551.1 bits, see alignment E=5.6e-170

Best Hits

Swiss-Prot: 76% identical to TGT_CUPTR: Queuine tRNA-ribosyltransferase (tgt) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K00773, queuine tRNA-ribosyltransferase [EC: 2.4.2.29] (inferred from 84% identity to bpt:Bpet3647)

MetaCyc: 65% identical to tRNA-guanine transglycosylase (Escherichia coli K-12 substr. MG1655)
tRNA-guanine transglycosylase. [EC: 2.4.2.29]

Predicted SEED Role

"tRNA-guanine transglycosylase (EC 2.4.2.29)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 2.4.2.29)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>ABCV34_RS15365 tRNA guanosine(34) transglycosylase Tgt (Castellaniella sp019104865 MT123)
MTGLQFDLLHTDGAARRGRLTLNHGVVQTPIFMPVGTYGSVKAMLPHELEDIGAQIVLGN
TFHLWLRPGTDVLDHHGGLHGFMQWDRPILTDSGGFQVFSLDGMRKITEEGVRFASPIDG
SRQFLSPEESMRIQRSLNSDIVMVLDECTPYRIGDRPATHEEAAASMRMSLRWARRSRQA
FQDLRNPNALFGIIQGGMYEDLRDESLAGLTDIGFEGYAIGGLSVGEPKEDMMRVLAHVA
PRMPAGAPRYLMGVGTPEDLVEGVRQGVDMFDCVMPTRNARNGWLFTRYGDVKIRNARYR
DDTRPLDPDCRCHTCSHFSRSYLHHLQRVGEITGARLNTLHNLHFYLNLMADMREAIEQD
RFESWRQAFLRDRARGIE