Protein Info for ABCV34_RS15265 in Castellaniella sp019104865 MT123

Annotation: cyclic pyranopterin monophosphate synthase MoaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00581: molybdenum cofactor biosynthesis protein C
  • amino acids 10 to 158 (149 residues), 191.4 bits, E=3.7e-61
• PF01967: MoaC
  • amino acids 21 to 156 (136 residues), 182 bits, E=2.7e-58

Best Hits

Swiss-Prot: 74% identical to MOAC_BORA1: Cyclic pyranopterin monophosphate synthase (moaC) from Bordetella avium (strain 197N)

KEGG orthology group: K03637, molybdenum cofactor biosynthesis protein C (inferred from 75% identity to put:PT7_2091)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC" in subsystem Molybdenum cofactor biosynthesis

Protein Sequence (164 amino acids)

>ABCV34_RS15265 cyclic pyranopterin monophosphate synthase MoaC (Castellaniella sp019104865 MT123)
MNGTEVSPTLTHLDENGQVRMVDVGAKAATARSAIAEGRVRLSPHAWRLLSAQANAKGEV
LNTARVAGILAAKRCAELIPLCHSLPLSFVGVDFTADDDTHTLTIRSTCRTSHQTGVEME
AMTACTVAALTVYDMCKAADKGILIEQVRLVYKSGGKSGEWRND