Protein Info for ABCV34_RS15090 in Castellaniella sp019104865 MT123

Annotation: AzlC family ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 transmembrane" amino acids 14 to 85 (72 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 185 to 215 (31 residues), see Phobius details PF03591: AzlC" amino acids 17 to 152 (136 residues), 135.3 bits, see alignment E=9.8e-44

Best Hits

KEGG orthology group: None (inferred from 61% identity to rfr:Rfer_2862)

Predicted SEED Role

"Branched-chain amino acid transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>ABCV34_RS15090 AzlC family ABC transporter permease (Castellaniella sp019104865 MT123)
MPRQPHHPLSISSLTAPVAMGYIPLGAVFGFLFVQAGGSGWLAIASSLLIYAGAAQFMMV
PMLAAGLPVSAIVLATLVLNLRHVFYGLSLLSHLPASRWQRWYGIFALTDETYSVLTALP
AQARSRRMALVCALNHGWWVLGTVLGVMLGAQVQIGLTGLDFVLAALFAVLAVEQWRARR
DTLPIWISLAAYAIALVILPAQALAIAIALSLLAAALRPATPPASTRDPDAASHD