Protein Info for ABCV34_RS15015 in Castellaniella sp019104865 MT123

Annotation: protein-methionine-sulfoxide reductase heme-binding subunit MsrQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 signal peptide" amino acids 5 to 6 (2 residues), see Phobius details amino acids 25 to 25 (1 residues), see Phobius details transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 146 to 163 (18 residues), see Phobius details amino acids 175 to 192 (18 residues), see Phobius details PF01794: Ferric_reduct" amino acids 43 to 156 (114 residues), 63.3 bits, see alignment E=1.1e-21

Best Hits

Swiss-Prot: 54% identical to MSRQ_RALSO: Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (msrQ) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: None (inferred from 56% identity to put:PT7_1702)

Predicted SEED Role

"FIG001196: Membrane protein YedZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>ABCV34_RS15015 protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (Castellaniella sp019104865 MT123)
MRSGVWLRVGVHAVGLFPLARWVVLGATQGLSANPQEFLTRSSGVWALALLWAVLCVTPA
RRLTGWTRLVRYRRALGLYAFFYTVLHVIAWAIWDRGGAPAAMWTDLWQRDFIGVGAIAV
LLLVPLALTSTNGWIRRLGRWWRRLHWLIHPAAVLSVLHFEWMRAGKNDFLEPRIYAVIL
AVLLGVRLWWWWENRAKQRFDQHRLG