Protein Info for ABCV34_RS15010 in Castellaniella sp019104865 MT123

Annotation: protein-methionine-sulfoxide reductase catalytic subunit MsrP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00174: Oxidored_molyb
  • amino acids 102 to 255 (154 residues), 113 bits, E=5.9e-37

Best Hits

Swiss-Prot: 58% identical to MSRP_RALSO: Protein-methionine-sulfoxide reductase catalytic subunit MsrP (msrP) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K07147, (no description) (inferred from 62% identity to bpt:Bpet1745)

MetaCyc: 58% identical to protein-L-methionine sulfoxide reductase catalytic subunit MsrP (Escherichia coli K-12 substr. MG1655)
1.8.5.M7 [EC: 1.8.5.M7]; 1.8.5.M7 [EC: 1.8.5.M7]

Predicted SEED Role

"Putative sulfite oxidase subunit YedY"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.5.M7

Protein Sequence (320 amino acids)

>ABCV34_RS15010 protein-methionine-sulfoxide reductase catalytic subunit MsrP (Castellaniella sp019104865 MT123)
MHVEQSRDIPPSGITPESVWLGRRRWLRQMAAGSLALGMGGLARASAGDGPTGPVLPAPP
NARWSTTEKPNSWHDITTYNNFYEFGTGKGDPAEYAGRMRLRPWAVKIDGAVGKPMTLDL
DDLRKLAPLEERVYRLRCVEAWSLVVPWIGYSLSHLLQRVEPTADARYVVFTSAVQPDVM
PGVRQRILDWPYVEGLRMDEAMHPLTLLTFGLYGHDLPPQDGAPLRIIVPWKYGFKSAKS
LVHIRLQAEQPVSSWMRAAPDEYGFYANVNPSVPHPRWSQATERRIGTGFFASRIPTLPF
NGYAESVAGLYQGMDLRRNF