Protein Info for ABCV34_RS14940 in Castellaniella sp019104865 MT123

Annotation: MMPL family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 773 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 256 to 275 (20 residues), see Phobius details amino acids 281 to 303 (23 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 351 to 371 (21 residues), see Phobius details amino acids 377 to 396 (20 residues), see Phobius details amino acids 426 to 447 (22 residues), see Phobius details amino acids 631 to 652 (22 residues), see Phobius details amino acids 660 to 677 (18 residues), see Phobius details amino acids 683 to 702 (20 residues), see Phobius details amino acids 714 to 733 (20 residues), see Phobius details amino acids 739 to 761 (23 residues), see Phobius details PF03176: MMPL" amino acids 249 to 403 (155 residues), 28.2 bits, see alignment E=4.7e-11

Best Hits

KEGG orthology group: None (inferred from 56% identity to eae:EAE_05635)

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (773 amino acids)

>ABCV34_RS14940 MMPL family transporter (Castellaniella sp019104865 MT123)
MPKLSTFNFRAALLWLAVCLAAAFWLVGRWTSVPINSSVLALLPVQSQDAAQAELETAFT
RRLDRQVVWMLSPGTQPDPLLAAQWRARMAAVPGVLEVQGPMTPQLRQQWLQFFYTYRNS
LLDAQTRARLQAGGNAQAQWVLAQLYSAFAGVGHQEIARDPLMLVRGTQMALLQGAGSLR
LVDGWLSTRDAEGRFWYFLPAQLQASSFDVSQTQALVTAFQREETAFLADHPQARVLSRG
SLFYSEHAAQQAGHDITVIGSVTILGVVLLILAAFRSLLPLLLCILSVGMGALWGTTLTV
ALFGEVHLMTLAMSLSVVGISVDYALYYLVERRSRVVEESPWCSMGRVRPALFMALGTSA
VAYLLLTLAPFPGIRQLAVFAAAGLCAACLTVVFWHPILARPLRAAPVPCLRQLDAWLQL
WRTRRLVRVGVPVLLAGLAVLALSRLPFSDDIAQLQEPPARIQAQDRHITELTGQSMDQK
WFLIAGQSPQQALERLDAFVPQLAQAQAAGWLQSYRALPLHSLNRQAEDQQLLQSAATEV
RQALAATGLEMPQADTRLTPLEPEVWLRSPASQGWRLLWLSLPNGASGVLVPVAGVRQEA
ALAALAQPAAGIHWVDRKAAFDQLFAHYRQVLSQLLLLALGGVCVVSIVRLGWRRGLRTS
VPSLLSLALGLGALSLFGRSANLFSLLALVLVLGIGINYTIFFGNSRGTPRTSLFAVLLA
MLTTLLTLGVLVFSSTRAISSFGIVLSAGIFAAFLLAPLALPDQASHPTNPSC