Protein Info for ABCV34_RS14925 in Castellaniella sp019104865 MT123

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 581 transmembrane" amino acids 239 to 252 (14 residues), see Phobius details amino acids 286 to 305 (20 residues), see Phobius details amino acids 490 to 511 (22 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 22 to 147 (126 residues), 68 bits, see alignment E=4.9e-23

Best Hits

KEGG orthology group: None (inferred from 60% identity to ddc:Dd586_4173)

Predicted SEED Role

"FIG143263: Glycosyl transferase / Lysophospholipid acyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (581 amino acids)

>ABCV34_RS14925 glycosyltransferase (Castellaniella sp019104865 MT123)
MNGKPVTSAPGGTAGADGLRCCIVIPCYNHGASLPAVLDRLAAFGLHCFIVDDGSELATR
VRINALDRQHAWVTALHLPTNQGKGGAVLHGFQAARQAGYQHALQIDADGQHEIDDIPRL
LAEARRHPDALVSGQPVYDESIPKARRYGRYLTHVWVWIETLSLQIRDAMCGFRVYPLAP
VLSLVQRVPMGRYMDFDPEVMVRLYWEGVPVRFVPTRVIYPEGGLSNFDAVRDNVRISWM
HTRLFFGMLWRLPQLLSRRRASHWAQREELKGLLGMRIMMRLYQTLGRGAFELALYPVVA
VYWLTAGAARRASRQWLEAVCRHAAATGMALPRGLNSYRHFRRFAQAMLDKIAGWRGDLV
LGRDVVLAPGTEAVLHPSMRRGTLILGAHLGDLEVCRALAEQMSGQVVTALVFTDHAQRY
NQILKEFSPQATVHLLSVRELGPETALMLQQKLDAGEWVAILGDRLSAGRTRAQAQRIVY
GAFMGRLAPFSAGPFVLAATLRAPVVLLFALRDGPQRVIHCESFDAPRLMPRSERPQRLQ
AMVDRYAQRLEHYALLSPLDWFNFYDFWQAPHQADPAKETP