Protein Info for ABCV34_RS14740 in Castellaniella sp019104865 MT123

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 128 to 144 (17 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details PF00892: EamA" amino acids 12 to 144 (133 residues), 54.3 bits, see alignment E=8.4e-19 amino acids 153 to 283 (131 residues), 35.8 bits, see alignment E=4.3e-13

Best Hits

KEGG orthology group: None (inferred from 42% identity to psa:PST_3734)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>ABCV34_RS14740 DMT family transporter (Castellaniella sp019104865 MT123)
MDTNLRAQKPWLGPVLMCVASLFFAILDTGTKYLAGHYPLLQIVWVRYMAQTVAIVLIFM
PRIGRQLFVAHRYPIQLFRGLCLCSSSVFVIHGLARLPLAEATAIVFLAPVIVTMLSGLL
LKEKARTMDWVAVASGFAGVLIIARPGGGLLTWAILFPMGSAMCNAFYQIVTRSTRSSEH
AATSNFYTGLVGVLALAPWGASDWMPMPAGDFLLLLGIGGIAAIGHLTITYALLHAPAAA
LGAYSYSQILWATLLGWAAFQAIPDAMAWLGILVIALGGILLSVPQVRQIGASMWRLRPR
RR