Protein Info for ABCV34_RS14565 in Castellaniella sp019104865 MT123

Annotation: helix-turn-helix transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13560: HTH_31" amino acids 11 to 90 (80 residues), 56.2 bits, see alignment E=3.5e-19 PF17765: MLTR_LBD" amino acids 111 to 256 (146 residues), 133.7 bits, see alignment E=7.2e-43

Best Hits

KEGG orthology group: None (inferred from 67% identity to put:PT7_3399)

Predicted SEED Role

"Putative DNA-binding protein in cluster with Type I restriction-modification system" in subsystem Restriction-Modification System

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>ABCV34_RS14565 helix-turn-helix transcriptional regulator (Castellaniella sp019104865 MT123)
MSRDDAARRQALGAFLRSARARVSPADHGLPSGLRRRTPGLRREEVAQLCGISTTWYTWI
EQGRDVSVSVEVWCRLAETLRLARAERHYLFSLAECTDPQTGHLDAVALPDGLSDCVDSI
RGPAYILDQSWNVLAWNPALQDLFDGWPGRGRANLLHFIFMDPAARTLVVDWEERASRVV
AEFRADVATLAGDPAIQALVAELQAGSPLFARCWTRQTVVEREGGVRAFQHPARGRLRLR
QFTFRLAIRPDCKLVMLLGDL