Protein Info for ABCV34_RS14495 in Castellaniella sp019104865 MT123
Annotation: D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 80% identical to HEPPA_BORBR: D-beta-D-heptose 1-phosphate adenylyltransferase (BB4463) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
KEGG orthology group: None (inferred from 80% identity to bpe:BP3602)MetaCyc: 46% identical to glycerol-3-phosphate cytidylyltransferase (Aquifex aeolicus)
Glycerol-3-phosphate cytidylyltransferase. [EC: 2.7.7.39]
Predicted SEED Role
"ADP-heptose synthase (EC 2.7.-.-) / D-glycero-beta-D-manno-heptose 7-phosphate kinase" in subsystem LOS core oligosaccharide biosynthesis (EC 2.7.-.-)
MetaCyc Pathways
- ADP-L-glycero-β-D-manno-heptose biosynthesis (4/5 steps found)
- 1-(sn-glycero-3-phospho)-1D-myo-inositol biosynthesis (1/3 steps found)
- lipid A-core biosynthesis (P. gingivalis) (1/7 steps found)
- poly(3-O-β-D-glucopyranosyl-N-acetylgalactosamine 1-phosphate) wall teichoic acid biosynthesis (2/10 steps found)
- poly(glycerol phosphate) wall teichoic acid biosynthesis (2/11 steps found)
- poly(ribitol phosphate) wall teichoic acid biosynthesis I (B. subtilis) (2/12 steps found)
- poly(ribitol phosphate) wall teichoic acid biosynthesis II (S. aureus) (2/14 steps found)
KEGG Metabolic Maps
- Glycerophospholipid metabolism
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
- Lipopolysaccharide biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.7.-.-
Use Curated BLAST to search for 2.7.-.- or 2.7.7.39
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (162 amino acids)
>ABCV34_RS14495 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase (Castellaniella sp019104865 MT123) MTGDARFEAKILSPAECEAAVRQGRFPRPLVFTNGVFDILHRGHVTYLDQAAQLGAALIV AVNTDASVRRLGKGPDRPLNAQEDRAALLAALACVDVVTWFDEDTPLELIQALRPDVIVK GGDYDMDTLPETAAVRGWGGSAVAIPFEHQRSTTALLKKIRR