Protein Info for ABCV34_RS14385 in Castellaniella sp019104865 MT123

Annotation: thiol reductant ABC exporter subunit CydD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 586 transmembrane" amino acids 35 to 57 (23 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details amino acids 257 to 282 (26 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details TIGR02857: thiol reductant ABC exporter, CydD subunit" amino acids 33 to 574 (542 residues), 592.1 bits, see alignment E=6.2e-182 PF00664: ABC_membrane" amino acids 44 to 285 (242 residues), 105.6 bits, see alignment E=5.9e-34 PF00005: ABC_tran" amino acids 387 to 535 (149 residues), 90.7 bits, see alignment E=2.1e-29

Best Hits

Predicted SEED Role

"Transport ATP-binding protein CydD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (586 amino acids)

>ABCV34_RS14385 thiol reductant ABC exporter subunit CydD (Castellaniella sp019104865 MT123)
MNDRSSLEYDPAILQPATPDQARWLRDLARLARAPLALASTAPLLAGGLLVLQSWLLAHV
LEAGFVQKASRDALLQPLAMIAALILARAALAWMAERAGARAAERIKHAVRRTLMRTLLA
AGPSWTRRRASGELAGAVVEQTEALDGYFSRYLPSMAAAVVLPIAFSLIILPVDLIAGLL
LLTTAPLIPLFMALVGWGAEAASRRHLRTFARLSGFFADRLRGLSTLKLHGRAQAEAEAV
AQASDTLRDRTLAVLRIAFLSSAVLEFFAALGVAGVAVYIGLSYLGYLNLRGQALSLQAG
FFCLLMAPEVYTPLRQFAAHYHDRAAARAAVAQIEASFDCLPAIDTPPPERPAGPPEARH
QFARDAGISVLAGPLRLSLPQRPRPILDGLSLSIQAGEHVALLGASGAGKTTLLEVLARL
QAAEGPLRLGGRLLAEWPEEDLRDQVVLIGQRPFLLQGSIADNIRLGRPDASPAEIADAA
RRACVTPFVSDLPQGLDSRIDPRGHGLSGGQAQRVALARLYLRDPGLILLDEPTAHLDDD
TQKAVLDGLLSFARGRTLLLVTHSPTVAQRLTRRILLTNGLIEAAA