Protein Info for ABCV34_RS14285 in Castellaniella sp019104865 MT123

Annotation: HesA/MoeB/ThiF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 transmembrane" amino acids 31 to 56 (26 residues), see Phobius details PF00899: ThiF" amino acids 9 to 245 (237 residues), 248.2 bits, see alignment E=5.4e-78

Best Hits

Swiss-Prot: 51% identical to UBAA_HALVD: SAMP-activating enzyme E1 (ubaA) from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)

KEGG orthology group: None (inferred from 70% identity to bpa:BPP0298)

MetaCyc: 51% identical to E1 SAMP-activating enzyme monomer (Haloferax volcanii)
RXN-18690 [EC: 6.2.1.55]; RXN-18689 [EC: 6.2.1.55, 2.7.7.100]; 2.3.2.- [EC: 6.2.1.55, 2.7.7.100]

Predicted SEED Role

"Sulfur carrier protein adenylyltransferase ThiF" in subsystem Thiamin biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.100 or 6.2.1.55

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>ABCV34_RS14285 HesA/MoeB/ThiF family protein (Castellaniella sp019104865 MT123)
MGDAQLMRYARHILLDELGIEGQERLLAARVLIIGAGGLGSPAALYLAAAGVGSILLVDD
DVVELSNLQRQVLHAMADLGQPKAESGRQALLAINPDIQVRALVERLDEPRLRELAGQVD
LVLDCTDNFATRHAINRACVATRTPLVSGAAIRFSGQISVYDLRDDASPCYHCLFPEADD
VEELRCATTGVLGPLVGMVGSVQAAEAIKIITGMGEPLVGRLLSVDALRMQWHTIRFRRD
PECPVCARRAPASAGYPGG