Protein Info for ABCV34_RS14080 in Castellaniella sp019104865 MT123

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 90 to 107 (18 residues), see Phobius details amino acids 113 to 136 (24 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 226 to 250 (25 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details amino acids 318 to 342 (25 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details amino acids 384 to 404 (21 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 348 (321 residues), 107.7 bits, see alignment E=6.4e-35 amino acids 233 to 405 (173 residues), 42 bits, see alignment E=6.1e-15 PF06779: MFS_4" amino acids 43 to 403 (361 residues), 38.4 bits, see alignment E=9.9e-14

Best Hits

KEGG orthology group: None (inferred from 36% identity to cef:CE2891)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>ABCV34_RS14080 MFS transporter (Castellaniella sp019104865 MT123)
MNAQAIPGPELGLDTLDGRAAARASLFLVLVGICAALHIWKLPPALPQLQAQFDLSLVQS
GFLLSVVQIGGMALGLPIGLVAERIGLRRCIVRGLGILAVASALGAWLDSGLMVLLCRAV
EGCGFLMVVMPIPSLIRRIVPPGMLSRIMGLWGTYMPLGTVITLLTGSWVLSLGNWQLLW
LLLSVLTLVFLLLTLRIVPGDPPHDAATPRPPALSLVGTTLRSPNVWLVALTFGAYSSQW
IAIIGFLPTIYATAGVAGPTAGLLTAIVAGVNAIGNLTAGRLLHHGFRAWHLLATGLGTM
IVCAYAAFGAHLPAIPQFLAVVTFSLVGGLVPATLFVLALTLAPTPQTTSTTIGWMQQCS
SFGQFIGPPLVAWVVNRAGDDWQWTWVATSLLAAIGIVLAILIGRRTRGIV